PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G28520.2
Common NameATVOZ1, F1K23.24, F3M18.4, VOZ1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family VOZ
Protein Properties Length: 486aa    MW: 54079.7 Da    PI: 5.8961
Description vascular plant one zinc finger protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G28520.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ444.81e-1362074231217
          VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                  pppsaflgpkcalwdc+rpaqg++w+qdycssfha+la+neg+pg++pv+rp+gi+lkdgllfaalsak+ gk+vgipecegaatakspwna+elfdl
  AT1G28520.2 207 PPPSAFLGPKCALWDCPRPAQGFDWFQDYCSSFHAALAFNEGPPGMNPVVRPGGIGLKDGLLFAALSAKAGGKDVGIPECEGAATAKSPWNAPELFDL 304
                  89************************************************************************************************ PP

          VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksa 196
                  ++le+et+rewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelklvd+kk++
  AT1G28520.2 305 TVLESETLREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQIMVEFGGLKRSYYMDPQPLHHFEWHLYEYEINKCDACALYRLELKLVDGKKTS 402
                  ************************************************************************************************** PP

          VOZ 197 kgkvskdsladlqkklgrlta 217
                  kgkvs+ds+adlqk++grlta
  AT1G28520.2 403 KGKVSNDSVADLQKQMGRLTA 423
                  *******************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009585Biological Processred, far-red light phototransduction
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0005417anatomyphloem
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009067anatomyfilament
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MTGKRSKTNC RSASHKLFKD KAKNRVDDLQ GMLLDLQFAR KESRPTDVTL LEEQVNQMLR  60
EWKSELNEPS PASSLQQGGT LGSFSSDICR LLQLCDEEDD ATSKLAAPKP EPADQNLEAG  120
KAAVFQRGYN LVQGKSEHGL PLVDNCKDLS LAAGNNFDGT APLEYHQQYD LQQEFEPNFN  180
GGFNNCPSYG VVEGPIHISN FIPTICPPPS AFLGPKCALW DCPRPAQGFD WFQDYCSSFH  240
AALAFNEGPP GMNPVVRPGG IGLKDGLLFA ALSAKAGGKD VGIPECEGAA TAKSPWNAPE  300
LFDLTVLESE TLREWLFFDK PRRAFESGNR KQRSLPDYNG RGWHESRKQI MVEFGGLKRS  360
YYMDPQPLHH FEWHLYEYEI NKCDACALYR LELKLVDGKK TSKGKVSNDS VADLQKQMGR  420
LTAEFPPENN TTNTTNNNKR CIKGRPKVST KVATGNVQNT VEQANDYGVG EEFNYLVGNL  480
SDYYIP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.408730.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864789610.0
Genevisible261467_at0.0
Expression AtlasAT1G28520-
AtGenExpressAT1G28520-
ATTED-IIAT1G28520-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Function -- GeneRIF ? help Back to Top
  1. VOZ1 and VOZ2 function in the vascular bundle to regulate flowering.
    [PMID: 22904146]
  2. Vascular plant one-zinc-finger proteins (VOZs) function as both negative and positive regulators of the abiotic and biotic stress-responsive pathways, and control Arabidopsis adaptation to various stress conditions.
    [PMID: 23167462]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G28520.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SGQ0
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. Voz1 and voz2 double mutant displays a late flowering phenotype under long-day conditions. {ECO:0000269|PubMed:22904146}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G28520
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1252560.0AB125256.1 Arabidopsis thaliana AtVOZ1 mRNA for transcription factor AtVOZ1, complete cds.
GenBankAK2270140.0AK227014.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-45-I22.
GenBankBT0202610.0BT020261.1 Arabidopsis thaliana At1g28520 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077618.10.0vascular plant one zinc finger protein
RefseqNP_174174.10.0vascular plant one zinc finger protein
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLD7KCX70.0D7KCX7_ARALL; Putative uncharacterized protein
STRINGAT1G28520.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Mitsuda N,Hisabori T,Takeyasu K,Sato MH
    VOZ; isolation and characterization of novel vascular plant transcription factors with a one-zinc finger from Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(7): p. 845-54
    [PMID:15295067]
  2. Laubinger S, et al.
    Dual roles of the nuclear cap-binding complex and SERRATE in pre-mRNA splicing and microRNA processing in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(25): p. 8795-800
    [PMID:18550839]
  3. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  4. Jensen MK, et al.
    The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling.
    Biochem. J., 2010. 426(2): p. 183-96
    [PMID:19995345]
  5. Min BE, et al.
    A host-factor interaction and localization map for a plant-adapted rhabdovirus implicates cytoplasm-tethered transcription activators in cell-to-cell movement.
    Mol. Plant Microbe Interact., 2010. 23(11): p. 1420-32
    [PMID:20923350]
  6. Mimida N, et al.
    Apple FLOWERING LOCUS T proteins interact with transcription factors implicated in cell growth and organ development.
    Tree Physiol., 2011. 31(5): p. 555-66
    [PMID:21571725]
  7. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  8. Yasui Y, et al.
    The phytochrome-interacting vascular plant one-zinc finger1 and VOZ2 redundantly regulate flowering in Arabidopsis.
    Plant Cell, 2012. 24(8): p. 3248-63
    [PMID:22904146]
  9. Nakai Y, et al.
    Vascular plant one-zinc-finger protein 1/2 transcription factors regulate abiotic and biotic stress responses in Arabidopsis.
    Plant J., 2013. 73(5): p. 761-75
    [PMID:23167462]
  10. Nakai Y,Fujiwara S,Kubo Y,Sato MH
    Overexpression of VOZ2 confers biotic stress tolerance but decreases abiotic stress resistance in Arabidopsis.
    Plant Signal Behav, 2013. 8(3): p. e23358
    [PMID:23299334]
  11. Celesnik H,Ali GS,Robison FM,Reddy AS
    Arabidopsis thaliana VOZ (Vascular plant One-Zinc finger) transcription factors are required for proper regulation of flowering time.
    Biol Open, 2013. 2(4): p. 424-31
    [PMID:23616927]
  12. Hwang SM, et al.
    Functional characterization of Arabidopsis HsfA6a as a heat-shock transcription factor under high salinity and dehydration conditions.
    Plant Cell Environ., 2014. 37(5): p. 1202-22
    [PMID:24313737]
  13. Yang X, et al.
    Homodimerization of HYL1 ensures the correct selection of cleavage sites in primary miRNA.
    Nucleic Acids Res., 2014. 42(19): p. 12224-36
    [PMID:25294831]